PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G437300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 638aa    MW: 71883.7 Da    PI: 7.2847
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G437300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.16.9e-094094461954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Aqcoe5G437300.1.p 409 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 446
                        564459******************************88 PP

2BELL108.44.3e-35273341472
               BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +lqk+ka+Lls+leeVd+rYkqy++q++ v+ssFeav+g g+a  Y +lA+ka+SrhFr L+dai+ q+
  Aqcoe5G437300.1.p 273 DLQKRKARLLSMLEEVDRRYKQYCNQMKSVVSSFEAVVGTGAASGYSALASKAMSRHFRTLRDAIVAQL 341
                        79****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.4E-56206339IPR006563POX domain
PfamPF075261.9E-44212338IPR006563POX domain
PROSITE profilePS5007112.098387450IPR001356Homeobox domain
SMARTSM003895.0E-9390454IPR001356Homeobox domain
CDDcd000863.05E-11390451No hitNo description
SuperFamilySSF466892.74E-17391456IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27393456IPR009057Homeodomain-like
PfamPF059208.5E-18407446IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MAGQSRQQGE MGSFGTHFLN QIPNFESNPE LYNLTTGMEM LTTFPSKNRD SSSSNSAVMW  60
KNNSFFSKQH QGVVHGHGRL IPGSSSSSSS TLKNINQSTN HDFYTADQFK QPDFSVGFSG  120
ASENLSWVVD GSSMRSIDYS CDERPNSTQG LSLSLCSNEL RGQTSHQQQQ DGFFGRSISF  180
QNQTPAEEEH ILQDGFMGSK ATAGSSNQHF QLKNSVYFTP AQELLNEFCS LGAKLNDQKK  240
KKKPQKTNQW EEENGLGSSR NKQPSLNSLD LLDLQKRKAR LLSMLEEVDR RYKQYCNQMK  300
SVVSSFEAVV GTGAASGYSA LASKAMSRHF RTLRDAIVAQ LKATKKAMGE KDPIAPGTTK  360
GETPRLRLLD QTLRQQKAFQ QMNMMENHPW RPQRGLPDRS VSILRAWLFE HFLHPYPSDV  420
DKHILARQTG LSRSQVSNWF INARVRLWKP MVEEMYLEET KEQDNFASLD RVTSLDENCR  480
PYENHSPNLN HQEDQKPTPN QLVRNDSESL SSIINNPEPK NGRHHNLHQQ QQQHRRQLGK  540
DPETFGVVDL DFSSYAASGV HQNFSNGVSL TLGLQQHGES GPMNLSFSPA SQHSLFFPRD  600
HMEDCEQVQY SFLDGGEGEN LPYRNLMSAQ LLHDYAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15396454563Homeobox protein Meis2
3k2a_B2e-15396454563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279230.20.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-130BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A061G6K40.0A0A061G6K4_THECC; POX family protein isoform 1
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-118TALE family protein